PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10036336
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 364aa    MW: 40003.6 Da    PI: 4.9117
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10036336genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.66.6e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rgrWT eEd++l +++   G g+W+  ++  g++R++k+c++rw +yl
      Lus10036336 14 RGRWTSEEDQILTKYILDNGEGSWRWLPKNAGLKRCGKSCRLRWINYL 61
                     8*********************************************97 PP

2Myb_DNA-binding491.4e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + eEd+ +v++   lG++ W++Ia++++ gRt++++k++w+++l
      Lus10036336  67 RGNISDEEDDVIVKLQSSLGNR-WSLIASHLP-GRTDNEIKNYWNSHL 112
                      7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.632961IPR017930Myb domain
SuperFamilySSF466892.87E-2611108IPR009057Homeodomain-like
SMARTSM007171.8E-81363IPR001005SANT/Myb domain
PfamPF002491.6E-111461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-191568IPR009057Homeodomain-like
CDDcd001679.38E-71661No hitNo description
PROSITE profilePS5129424.59862116IPR017930Myb domain
SMARTSM007173.2E-1566114IPR001005SANT/Myb domain
PfamPF002493.2E-1367112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-2469116IPR009057Homeodomain-like
CDDcd001671.79E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009813Biological Processflavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MGRAPCCEKI GLKRGRWTSE EDQILTKYIL DNGEGSWRWL PKNAGLKRCG KSCRLRWINY  60
LRGDLKRGNI SDEEDDVIVK LQSSLGNRWS LIASHLPGRT DNEIKNYWNS HLSRKVHSFR  120
RLVGNEPRLK LIVDTSSKVR TVGDGSNSKP LKSLSTKKGK TKKLVSNKGK IHNKVVVANS  180
GNDTLPSLEN VPPSDQNIRD RNAKEKQGVT LSATAPFSGI SDDGSIYDVE LDFLDGLMDS  240
EIANGPFALN EEGQSSVGHT ADTIMGQGHD VDDEGSGPIK SCDDVDTDGV VNIGSVEGTL  300
ECCWPTWSWE DVVVAGHEPL DDVVKFSNGD DDSLDLCKWS WDCEEVAGSS QEMDNDLVAW  360
LLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C5e-23121162105C-Myb DNA-Binding Domain
1mse_C5e-23121162105C-Myb DNA-Binding Domain
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGBRADI1G64687.15e-70(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.12e-70myb domain protein 12